| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |





From the Department of Dermatology,* Hokkaido University Graduate School of Medicine, Sapporo; the Department of Medicine,
Kurume University School of Medicine, Kurume; and the Department of Biochemistry,
Faculty of Pharmaceutical Science, Hokuriku University, Kanazawa, Japan
| Abstract |
|---|
|
|
|---|
Pigment epithelium-derived factor (PEDF), a glycoprotein that belongs to the superfamily of serine protease inhibitors, was first purified from human retinal pigment epithelial cell-conditioned media as a factor with potent human retinoblastoma cell neuronal differentiating activity.4 Recently, PEDF has been shown to be a potent inhibitor of angiogenesis in both cell culture and animal models. Indeed, PEDF is reported to inhibit retinal endothelial cell growth and migration and suppress ischemia-induced retinal neovascularization.5,6 Furthermore, loss of PEDF was associated with angiogenic activity in proliferative diabetic retinopathy.7 However, a functional role for PEDF in tumor growth and angiogenesis remains to be elucidated.
In this study, we investigated both in vitro and in vivo growth characteristics of the human malignant melanoma cell line G361, stably transfected to overexpress human PEDF.
| Materials and Methods |
|---|
|
|
|---|
Two human malignant melanoma cell lines G361 and A375 (American Type Culture Collection, Manassas, VA) were maintained in RPMI 1640 supplemented with 10% fetal calf serum, 100 U/ml penicillin/streptomycin. Normal human neonatal melanocytes were purchased from Kurabo (Osaka, Japan) and maintained according to the manufacturers instructions.
BALB/c-nu/nu mice were purchased from Japan Clea (Tokyo, Japan) and maintained under specific pathogen-free conditions. All animal procedures were conducted according to guidelines provided by the Hokkaido University Institutional Animal Care and Use Committee under an approved protocol.
Preparation of Polyclonal Antibodies against Human PEDF
Polyclonal antibody against 44-mer PEDF peptides(VLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSFDIHGT)was prepared as previously described.8 We confirmed that the polyclonal antibody actually bound to purified PEDF protein (data not shown).
Immunofluorescence Microscopy
Immunofluorescence staining was performed on G361, A375, or normal melanocytes cultured on glass coverslips. Each cell type was incubated with an anti-PEDF antibody at 4°C overnight, and then these primary antibodies were detected with fluorescein isothiocyanate-labeled goat anti-rabbit IgG (Vector Laboratories, Burlingame, CA). Fluorescence staining was detected using a confocal laser-scanning fluorescence microscope (Laser Scanning Confocal Imaging System MRC 1024; Bio-Rad, Richmond, CA).
Construction of PEDF Expression Vector
PEDF cDNA was originally cloned from a human placenta cDNA library (Clontech, Palo Alto, CA), and inserted into the mammalian expression vector pBK-CMV (Stratagene, La Jolla, CA) as described previously.8
Purification of PEDF Proteins
293T cells (American Type Culture Collection, Rockville, MD) were transfected with a PEDF expression vector using the FuGENE 6 transfection reagent (Roche Diagnostics, Mannheim, Germany) according to the manufacturers instructions. Then PEDF proteins were purified from conditioned media by a Ni-NTA spin kit (Qiagen GmbH, Hilden, Germany) according to the manufactures instructions. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis of purified PEDF proteins revealed a single band with a molecular weight of
50 kd, which showed reactivity with the previously described antibody against human PEDF.8
Selection of Stable Transfectants Overexpressing PEDF
Subconfluent G361 or A375 cultures were stably transfected either with a PEDF expression vector or with an expression vector alone using the FuGENE 6 transfection reagent. Twenty-four hours after transfection, cells were split 1:3 into their full growth medium containing 400 µg/ml of Zeocin (Invitrogen, Carlsbad, CA) to select transfectants. Stably transfected clones were expanded, and the clones were characterized for PEDF production.
Western Blot Analysis
G361, A375, and normal melanocytes were grown to confluence in 100-mm dishes, washed with phosphate-buffered saline (PBS), and lysed as previously described.9
Conditioned medium was obtained from stably transfected G361 cells grown for 48 hours in serum-free culture medium, and then concentrated 20-fold using Microcon 10 MWCO filters (Amicon, Beverly, MA). Proteins were electrophoresed on polyacrylamide gels under reducing conditions, and then blotted onto nitrocellulose filters. Filters were blocked with nonfat dried milk and followed by incubation with a primary antibody against human PEDF, human vascular endothelial growth factor (VEGF) (Santa Cruz Biotechnology, Santa Cruz, CA), or
-tubulin (Santa Cruz Biotechnology). After incubation, the filters were treated with horseradish peroxidase-conjugated anti-rabbit IgG (Amersham Pharmacia Biotech, Piscataway, NJ), and the resultant immune complexes were visualized using an enhanced chemiluminescence detection system (ECL) (Amersham) as previously described.8
Growth of G361 Xenografts in Nude Mice
Confluent G361 cells, stably transfected with the human PEDF expression vector or with the expression vector alone, were trypsinized and resuspended in PBS at a density of 1 x 107 cells/ml. One million tumor cells were injected intradermally into the flanks of each 6-week-old female athymic nude mouse (n = 5). The smallest and largest diameters of the tumors were measured after a 5-day interval using a pair of digital calipers, and the tumor volumes were calculated using the following formula: volume (mm3) = [(smallest diameter)2 x (largest diameter)]/2.10
Immunofluorescence Staining of Tumor Vessels
To determine the degree of tumor-induced angiogenesis, cryostat sections were prepared from tumor xenografts 30 days after implantation. Five cryostat sections of each tumor xenograft were stained with fluorescein isothiocyanate-conjugated rat anti-mouse CD31 (PharMingen, San Diego, CA). Nuclei were stained with propidium iodide. Three different fields at x60 magnification were examined on each section using a confocal laser-scanning fluorescence microscopy. The percentage of fluorescent-positive areas in three different fields from each section was measured.
Cell Growth and Apoptosis Assays
G361 cells, stably transfected with the human PEDF expression vector or with the expression vector alone, were serum-starved for 24 hours, and cell numbers were counted at days 2, 4, and 6 using a dye exclusion method. To investigate effects of PEDF proteins on the growth and apoptosis of nontransfected G361 cells, the cells were incubated with or without various concentrations of PEDF proteins in the presence or absence of 10 µg/ml of monoclonal antibody against Fas ligand (PharMingen). After 6 days of incubation, viable cell numbers were determined. Apoptosis was measured with an enzyme-linked immunosorbent assay for DNA fragments after a 16-hour incubation according to the manufacturers instructions (Cell Death Detection ELISA; Roche Molecular Biochemicals, Mannheim, Germany).
Assay for in Situ Apoptosis
To determine the degree of apoptosis, cryostat sections were prepared from tumor xenografts 30 days after implantation. Terminal dUTP nick-end labeling (TUNEL) assay was performed using in situ apoptosis detection kit (Boehringer Mannheim, Mannheim, Germany). The number of apoptotic cells was counted in 10 randomly selected fields at x200 magnification using an immunofluorescence microscope.
Statistical Analysis
All values were presented as means ± SEM (standard error of the mean). Statistical significance was evaluated using the Students t-test for paired comparison; P < 0.05 was considered significant.
| Results |
|---|
|
|
|---|
The human malignant melanoma cell lines G361 and A375 were chosen for their endogenous expression of PEDF and VEGF. As shown in Figure 1, A and B
, G361 and A375 cells were found to express substantial amounts of PEDF, and the expression levels of PEDF in these tumor cells were comparable with that of normal human cultured melanocytes. In contrast, expression levels of VEGF among these cells were quite different; G361 and A375 cells were characterized by a strong expression of VEGF, whereas little VEGF protein was detected in cell lysates from normal melanocytes (Figure 1B)
.
|
|
Next, we examined whether PEDF overexpression influences the tumor growth of G361 cells in vivo. As shown in Figure 3
, control vector-transfected cells formed rapidly growing tumors, reaching 300 to 400 mm3 after 30 days. In contrast, PEDF overexpression almost completely inhibited in vivo tumor growth of G361 cells throughout this observation period of up to 30 days (Figure 3)
.
|
To determine the tumor-induced angiogenesis within PEDF-transfected and control vector-transfected tumors, five different frozen sections from each tumor were stained with an antibody against mouse CD31. As shown in Figure 4
, morphometric analysis revealed decreased tumor vessels in 30-day-old tumors derived from the PEDF-overexpressing G361 cells, compared with control vector-transfected tumor cells.
|
To determine whether PEDF overexpression influences tumor cell proliferation in vitro, we measured growth rates of cultured G361 cells, stably transfected with a human PEDF expression vector or with the expression vector alone. As shown in Figure 5A
, growth rates of PEDF transfectants were significantly lower than that of control vector-transfected cells. Furthermore, PEDF proteins dose dependently retarded growth and induced apoptotic cell death in cultured nontransfected G361 cells, which was completely blocked by treatments with a neutralizing antibody against Fas ligand (Figure 5, B and C)
. These results suggest that PEDF elicits apoptosis in G361 cells indirectly, in a Fas ligand-dependent manner.
|
Finally, we examined apoptosis in the PEDF-transfected and control vector-transfected tumors, frozen sections from each tumor were analyzed using TUNEL assay. As shown in Figure 6
, apoptotic cells were significantly increased in the tumors derived from the PEDF-overexpressing G361 cells, compared with control vector-transfected tumor cells.
|
| Discussion |
|---|
|
|
|---|
In this present study, we found for the first time that overexpression of PEDF decreases tumor angiogenesis and almost completely inhibits the growth of G361 melanoma xenografts in nude mice. PEDF is also known to effectively suppress retinal and choroidal neovascularization caused by ischemia and age-related macular degeneration, respectively.6,16 Very recently, Doll and colleagues17 reported that PEDF inhibits stromal vasculature and epithelial tissue growth, mediating an anti-cancer effect for pancreas cancer. Blocking tumor vascularization using PEDF may also be a promising approach for melanoma treatment. Previous studies have shown that malignant melanoma responds well to anti-angiogenic therapy using other endogenous angiogenic inhibitors such as angiostatin (plasminogen kringles 1 to 4) and endostatin.18,19 Because plasminogen kringle 5 was recently reported to inhibit ischemia-induced retinal neovascularization in a rat model by down-regulating VEGF and up-regulating PEDF,20 the anti-angiogenic and growth inhibitory effects of angiostatin on melanoma cells could be ascribed, at least in part, to this PEDF activity.
It is possible that the concentrations used in these present studies (up to 100 nmol/L) were beyond the normal physiological concentrations, and the inhibitory effect was nonspecific toxicity. However previous studies have shown, for example, complete inhibition of vessel formation that was obtained at a concentration of
50 nmol/L.21
In addition, the estimated human blood concentration of PEDF is 100 nmol/L, which is a functionally significant concentration of PEDF in our studies, indicating that the blood circulation itself holds the capacity to inhibit angiogenesis in tissues throughout the entire body.22
Therefore the PEDF concentrations in our experiments may not be too high and remain within the parameters found under normal physiological conditions. Furthermore, we experimented the assay for in situ apoptosis to determine whether exogenous PEDF within tumor induces apoptosis. We could show that apoptotic cells were significantly increased in the tumors derived from the PEDF-overexpressing G361 cells, compared with control vector-transfected tumor cells (Figure 6)
. This result suggested that the endogenous PEDF in our animal model was not physiologically at too high a level to induce nonspecific toxicity, because nonspecific toxicity resulted in necrosis.
Here, we have been the first to identify a PEDF-induced growth retardation and induction of apoptotic cell death in melanoma cells that is dependent on the Fas ligand. PEDF up-regulates Fas ligand in endothelial cells, thereby specifically sensitizing tumor vessels to apoptosis.23 PEDF could directly elicit apoptosis in G361 cells by inducing Fas ligand on these tumor cells. Recently, granulocytes have been shown to inhibit melanoma lung metastasis by inducing Fas ligand-associated apoptosis, further supporting this speculation.24
Our present study has highlighted two beneficial aspects of the effects of PEDF on melanoma growth and expansion; one is the suppression of tumor angiogenesis, and the other is induction of Fas ligand-dependent apoptosis in tumor cells. PEDF is therefore a promising novel therapeutic agent for treatment of patients with certain types of cancer including melanoma.
| Acknowledgements |
|---|
| Footnotes |
|---|
Supported in part by the Japan Society for the Promotion of Science (grants-in-aid for scientific research to H.S. and R.A.); and the Ministry of Education, Culture, Sports, Science, and Technology, Japan (grants of Venture Research and Development Centers to S.Y.).
Accepted for publication December 10, 2003.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
T.-C. Ho, S.-L. Chen, Y.-C. Yang, C.-L. Liao, H.-C. Cheng, and Y.-P. Tsao PEDF induces p53-mediated apoptosis through PPAR gamma signaling in human umbilical vein endothelial cells Cardiovasc Res, November 1, 2007; 76(2): 213 - 223. [Abstract] [Full Text] [PDF] |
||||
![]() |
C.R. Dass, T.M.N. Tran, and P.F.M. Choong Angiogenesis Inhibitors and the Need for Anti-angiogenic Therapeutics Journal of Dental Research, October 1, 2007; 86(10): 927 - 936. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. W. T. Cheung, S. C. L. Au, A. N. Y. Cheung, H. Y. S. Ngan, J. Tombran-Tink, N. Auersperg, and A. S. T. Wong Pigment Epithelium-Derived Factor Is Estrogen Sensitive and Inhibits the Growth of Human Ovarian Cancer and Ovarian Surface Epithelial Cells Endocrinology, September 1, 2006; 147(9): 4179 - 4191. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Ushio-Fukai Redox signaling in angiogenesis: Role of NADPH oxidase Cardiovasc Res, July 15, 2006; 71(2): 226 - 235. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. T.H. Ek, C. R. Dass, and P. F.M. Choong Pigment epithelium-derived factor: a multimodal tumor inhibitor. Mol. Cancer Ther., July 1, 2006; 5(7): 1641 - 1646. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Maik-Rachline and R. Seger Variable phosphorylation states of pigment-epithelium-derived factor differentially regulate its function Blood, April 1, 2006; 107(7): 2745 - 2752. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Filleur, K. Volz, T. Nelius, Y. Mirochnik, H. Huang, T. A. Zaichuk, M. S. Aymerich, S. P. Becerra, R. Yap, D. Veliceasa, et al. Two Functional Epitopes of Pigment Epithelial-Derived Factor Block Angiogenesis and Induce Differentiation in Prostate Cancer Cancer Res., June 15, 2005; 65(12): 5144 - 5152. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Nyberg, L. Xie, and R. Kalluri Endogenous Inhibitors of Angiogenesis Cancer Res., May 15, 2005; 65(10): 3967 - 3979. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Garcia, N. I. Fernandez-Garcia, V. Rivas, M. Carretero, M. J. Escamez, A. Gonzalez-Martin, E. E. Medrano, O. Volpert, J. L. Jorcano, B. Jimenez, et al. Inhibition of Xenografted Human Melanoma Growth and Prevention of Metastasis Development by Dual Antiangiogenic/Antitumor Activities of Pigment Epithelium-Derived Factor Cancer Res., August 15, 2004; 64(16): 5632 - 5642. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |